Skip to main content

Advertisement

Table 1 The initial amino acid sequences including binding sites and folding energies (RT units) are shown for the 10 proteins. Additionally, the three ligands for each protein are shown with their initial binding energies (also RT units) at the two sites (A in italics and B in bold). It should be noted that the two binding sites are adjacent in three dimensions and overlap by one amino acid.

From: Subfunctionalization of duplicated genes as a transition state to neofunctionalization

  Sequences Conf. Eng. Binding Site A Ligand A Ligand Eng. at A Binding Site B Ligand B Ligand Eng. at B Ligand C Ligand Eng. at A Ligand Eng. at B
1 MSK TAQK R LLKELQQLIKDSPPGIVAGPKSEN
NIFI WDCLIQGPPDTPYA DGV FNAKLEFP KDY
-0.78 R PAV YRGM -0.84 R KIK YSMD -1.42 YLEG +0.59 +0.40
2 MSTP ARRRLMRDFKRMKEDAPPGVSASPL PDN
VMVWNAMI IGPA DTPYE DGTFR LLLEFDEEYP
-0.73 E ALI EIIL -1.07 E RTP EERQ -1.54 EKEP +0.79 +0.58
3 MTTSKERHSVSKRLQQELRT LL MSGDPGITAF
PD GDN LFKWVATLDGPKDTVYES LKYKLTLEF
-0.68 T LLS SILL -0.51 T NDP SDEW -0.81 STYL +0.61 +0.23
4 MNM SGIALSRLAQERKAW RKDHPFGFVAVPT K
NPD G TMNL MNWECAIPGKKGTPWEGGLFKLRM
-0.88 D LTW GFHW -0.83 D GMN GTFE -1.22 GEEC +0.29 +0.60
5 MSTPARKRLMRDFKRLQQDPPAGISGAPQD N N
IMLWNAV IFGPDDTPWDGG TFKLS LQFSEDYP
-0.66 D NSG GTDD -0.86 D NAV GTWF -0.64 GIFH +0.80 +0.53
6 MIV PYNLPLPGGVVPRMLITILGTVKP NANRI
ALDFQ R GNDV AFHFNPRFNENNRRVIVCNTKL
-1.00 R VKP YLEE -1.61 R QVV YKII -1.13 YQRD +0.78 +0.92
7 MT EENSKSEALLDIPMLEQYLELVG PKL I TDG
LAVFEKMMPGYVSVLES NLTAQDKKGIVEEGH
-0.96 I GSE ATEY -0.84 I LGT AIPG -1.00 AEFF +0.59 +0.90
8 MEAVIKVISSACK TYCGKTSPS KKEIGAM LS L
LQ KEGLLMSPSDLYSPGSWDPITAALSQ RAMI
-0.64 Q MSK YWQY -1.22 Q SQS YEPG -1.04 YRFF +0.84 +0.75
9 MDE PPA DGALKRAEELK TQA ND Y FKAKDYENA
IKFYSQAIELNPSNAIYYGNRSLAYLRTECYG
-0.37 Y AKL EITF -0.71 Y DED EKKT -1.92 EMVR +0.94 +1.32
10 MKSR RWFHPNIT GVE AENLLLTRGVDGSFLAR
P SKSNPGDLTLSVRRNGAVTHIKIQNTGDYY D
-1.45 T ERP ASER -1.47 T YRS AMDD -1.25 ALIL +1.18 +0.82